PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00194.1.g00100.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 847aa    MW: 92363 Da    PI: 5.742
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00194.1.g00100.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-181472357
                                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                    k  ++t+eq+e+Le+l++++++ps  +r++L + +    +++ +q+kvWFqNrR +ek+
  Zpz_sc00194.1.g00100.1.sm.mkhc 14 KYVRYTPEQVEALERLYYECPKPSSLRRQQLVRDCpvlaNVDPKQIKVWFQNRRCREKQ 72
                                    6789*****************************************************97 PP

2START173.11.8e-541673742204
                                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEE CS
                           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakae 80 
                                     +ae++++e+++ka+ ++  Wv+++ +++g++++ +++ s+++ g a+ra+g+v m++a  v+e+l+d++ W ++++++e
  Zpz_sc00194.1.g00100.1.sm.mkhc 167 IAEQTLTEFLSKATGTAVEWVQMPGMKPGPDSIGIIAISHGCAGVAARACGLVGMEPA-KVAEILKDRPLWLRDCRSME 244
                                     689999****************************************************.8888888888********** PP

                                     EEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEE CS
                           START  81 tlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgil 153
                                     +++v+  g  g+++l +++l+a+++l+p Rdf+ +Ry+  l +g++v++++S++s+q  p+    ++++R+e+lpSg+l
  Zpz_sc00194.1.g00100.1.sm.mkhc 245 VVNVLPAGnsGTIELLYMQLYAPTTLAPaRDFWLLRYTSILDDGSLVVCERSLSSKQGGPTmplVQPFIRGEMLPSGFL 323
                                     ************************************************************999999************* PP

                                     EEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                           START 154 iepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                                     i+p+++g+s +++v+h+dl+ +++++++r+l++s+++ ++k+ +a+l++++
  Zpz_sc00194.1.g00100.1.sm.mkhc 324 IRPSDGGGSVIHIVDHMDLEPWSVPEVVRPLYESSAMVAQKMSMAALRYLR 374
                                     ***********************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.337973IPR001356Homeobox domain
SMARTSM003891.2E-141177IPR001356Homeobox domain
PfamPF000464.0E-161472IPR001356Homeobox domain
CDDcd000862.01E-151474No hitNo description
SuperFamilySSF466892.44E-161575IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-171672IPR009057Homeodomain-like
CDDcd146864.14E-666105No hitNo description
PROSITE profilePS5084825.951157376IPR002913START domain
CDDcd088753.73E-73161375No hitNo description
Gene3DG3DSA:3.30.530.205.2E-22164371IPR023393START-like domain
SMARTSM002346.2E-45166376IPR002913START domain
SuperFamilySSF559612.75E-36166376No hitNo description
PfamPF018523.6E-52167374IPR002913START domain
PfamPF086704.9E-48703846IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010014Biological Processmeristem initiation
GO:0010075Biological Processregulation of meristem growth
GO:0010087Biological Processphloem or xylem histogenesis
GO:0048263Biological Processdetermination of dorsal identity
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MVTAKEAAAM DASKYVRYTP EQVEALERLY YECPKPSSLR RQQLVRDCPV LANVDPKQIK  60
VWFQNRRCRE KQRKESSRLQ ALNRKLTAMN KLLMEENDRL QKQVSQLVYE NGYYRQQTQS  120
AGLATTDTSC ESVVTSGQQN VAAAAAAAAA APQAQPRDAS PAGLMSIAEQ TLTEFLSKAT  180
GTAVEWVQMP GMKPGPDSIG IIAISHGCAG VAARACGLVG MEPAKVAEIL KDRPLWLRDC  240
RSMEVVNVLP AGNSGTIELL YMQLYAPTTL APARDFWLLR YTSILDDGSL VVCERSLSSK  300
QGGPTMPLVQ PFIRGEMLPS GFLIRPSDGG GSVIHIVDHM DLEPWSVPEV VRPLYESSAM  360
VAQKMSMAAL RYLRQVANED TQSVITGWGR QPTALRALSQ KLTRCCNEAI NGLADDGWSV  420
IESDGVDDVC ISVNSSPTKV INCNATFNNG LPIVSSSVLC AKASMLLQDV SPASLLRFMR  480
EQRSQWADSS LDAFFASAMK PNFCNLPMSR LGGFSGQVIL PLAHMFDPEE FLEVIKLGNA  540
SNYQDALMHR DLFLLQMYNG VDENTSGTCS ELIFAPIDAS FSDDSPLLPS GFRIIPIDSP  600
LDSSSPNCTL DLASTLEVGT PRIRVTGNCP ANSSCASSKS VMTIAFQFAF ERHLQDSVAT  660
MARQYVRSII QSVQRIALAL SSSRPVPQCG VSHTPAISPE AATLSIWICQ SYRFHFGAEL  720
IKSADSGSCE PSLKALWHHA SAILCCSLKA MPVFSFANQS GLDMLETTLV SLQDITLEKV  780
FDDQGGKNLC TELPTIMEQG FACLPGGLCV SSLGRPVSYE KALAWKVLDD VNCARCICFM  840
FVNWSFV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00200DAPTransfer from AT1G52150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454995.10.0hypothetical protein SORBIDRAFT_03g002660
SwissprotA2WLR50.0HOX29_ORYSI; Homeobox-leucine zipper protein HOX29
TrEMBLC5XLT30.0C5XLT3_SORBI; Putative uncharacterized protein Sb03g002660
STRINGSb03g002660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52150.10.0HD-ZIP family protein